@nikkietutorials

50 videos

295 M views

13 M likes

55 k comments

Total videos

analyzed

Total views

295 M

5,9 M avg / video

Avg engagement

6,6 %

Total likes

13 M

All Videos (20 / 50)

Sort

Description								Transcript		Tags	Audio
@Too Faced the Peach Collection is BACK… and apparently SO AM I!? Let’s dive back into this Peach nostalgia and fall in love with the scents, colors and vibes all over again! 🍑✨ @Ulta Beauty #toofacedpartner	23 M	4.1×	x 0,9 %	198 k	ven. 10 juil., 17:02	2,8 k	6,2 k	-	2:50	toofacedpartner	original sound nikkietutorials
apparently Wet n Wild has even more duochrome magic, so let’s give these Chameleon Chrome Lip Foils a try! #foryou #fyp	1,4 M	–	x 10,4 %	144 k	mar. 7 juil., 17:04	421	1,1 k	-	1:28	foryoufyp	original sound nikkietutorials
tap tap tap = filter-like skin in seconds ✨ oh, @loréal paris usa the hype is REAL! 😭❤️ infallible cushion foundation now available exclusively at @Ulta Beauty #LOrealParisPartner #LOrealParisMakeup #MakeupWorthSetting	4,4 M	–	x 1,4 %	60 k	mer. 1 juil., 16:55	478	1,3 k	-	1:08	lorealparispartnerlorealparismakeupmakeupworthsetting	original sound nikkietutorials
finally trying the VIRAL magical duochrome “Genesis” shadow by Lethal Cosmetics! Is it really THAT good? @India @Lethal Cosmetics #foryou #fyp	1,1 M	–	x 11,1 %	117 k	dim. 28 juin, 16:59	831	4,6 k	-	1:34	foryoufyp	original sound nikkietutorials
Line it. Stain it. Glaze it. 💋✨ how INSANE are the Lip Stain & Sculpt + Ultra Shine Lip Glaze from @MCoBeauty UK + @MCoBeauty EU - Luxury beauty without the luxury price tag 💖 OBSESSED! #KissThis #MCoBeautyPartner #MCoBeauty	2,2 M	–	x 1,3 %	29 k	jeu. 25 juin, 17:00	125	205	-	1:48	kissthismcobeautypartnermcobeauty	original sound nikkietutorials
FINALLY got my hands on the VIRAL dual-ended dupe lipstick 👀✨ Laka Perfect Twin Lip 💋 @Laka US #lakapartner #perfecttwinlip #LakaNewArrivals #foryou #fyp	1,6 M	–	x 1,7 %	26 k	dim. 21 juin, 17:00	285	487	-	1:35	lakapartnerperfecttwinliplakanewarrivals	original sound nikkietutorials
#COSRXPartner Want to know how to pump and plump that skin like a balloon? 🩵💙 The Blue Peptide Bakuchiol Plump Glow Serum by @COSRX Official will give you that kick of bounce ✨😎 #COSRX #KoreanSkincare #PeptideSerum #CopperPeptide	373 k	–	x 3,4 %	13 k	ven. 19 juin, 16:58	84	142	-	1:40	cosrxpartnercosrxkoreanskincare	original sound nikkietutorials
the cheeks of my DREAMS ⋆ using the new @Juvia’s Place Blushed and Bronzed Blurring Pro Palette - soft, buildable and impossible to overdo! @Tijera Fleming #blushbronzeblur#juviasplacepartner #foryou #fyp	9 M	–	x 0,8 %	68 k	dim. 14 juin, 16:55	331	975	-	1:29	blushbronzeblurjuviasplacepartnerforyou	original sound nikkietutorials
23 MILLION views later, I finally tried the VIRAL @missha.official M Perfect Cover Serum BB Cream… and everything makes sense now! #MISSHA #MISSHAPartner #MisshaNewArrivals #foryou #fyp	1,7 M	–	x 2,7 %	46 k	ven. 12 juin, 17:01	185	733	-	1:50	misshamisshapartnermisshanewarrivals	original sound nikkietutorials
for the people who still need to know they’re going to be okay… HAPPY PRIDE! @Nimya by NikkieTutorials #foryou #fyp	567 k	–	x 14,8 %	82 k	jeu. 11 juin, 16:53	970	994	-	1:17	foryoufyp	original sound nikkietutorials
ngl I kinda ate that last part… (never been more grateful I’m good at makeup) #foryou #fyp #actingchallenge	1,2 M	–	x 10,9 %	126 k	dim. 7 juin, 17:00	550	4,9 k	-	1:02	foryoufypactingchallenge	original sound nikkietutorials
finally trying Moroccan lipstick/lipstain, also known as “aker fassi”! WOW @NikkisSecretx #akerfassi #foryou #fyp	10 M	–	x 6,8 %	691 k	dim. 31 mai, 16:55	3,3 k	15 k	-	1:46	akerfassiforyoufyp	original sound nikkietutorials
is this the most FULL COVERAGE foundation ever? finally trying the VIRAL @PIMBY products! #foryou #fyp	3,5 M	–	x 9,2 %	318 k	lun. 25 mai, 16:56	1,3 k	2,6 k	-	1:44	foryoufyp	original sound nikkietutorials
YES! You heard that right… @SHEGLAM available at Kruidvat in The Netherlands + Belgium - gone are the days of waiting for packages to arrive, HALLELUJAH! #sheglam #sheglampartner #kruidvat #fyp #foryou	676 k	–	x 6,4 %	41 k	dim. 17 mai, 16:59	456	2,1 k	-	1:23	sheglamsheglampartnerkruidvat	original sound nikkietutorials
trying a look with FEATHERS.. cause why not?? @Baya 🦋 @aliyah #foryou #fyp	1,9 M	–	x 11,3 %	209 k	jeu. 14 mai, 17:01	1 k	4,5 k	-	1:41	foryoufyp	original sound nikkietutorials
finally got my hands on the viral GREEN(?!) Wet n Wild duochrome eyeshadow! @Rose Siard #foryou #fyp	18 M	3.1×	x 8,1 %	1,4 M	lun. 11 mai, 17:01	5,3 k	23 k	-	1:31	foryoufyp	original sound nikkietutorials
the routine your undereyes have been waiting for: Eye Duo from @Beauty of Joseon - powered by ginseng & retinal, backed by clinical results! #beautyofjoseonpartner #foryou #fyp	7,3 M	–	x 1,2 %	87 k	mar. 5 mai, 17:06	391	1,1 k	-	1:44	beautyofjoseonpartnerforyoufyp	original sound nikkietutorials
trying GLOWING makeup… @muamason #foryou #fyp	1,4 M	–	x 11,3 %	156 k	jeu. 30 avr., 17:01	685	917	-	1:45	foryoufyp	original sound nikkietutorials
“Frost Bite” really is THE ONE! @SHEGLAM these new shades are everything! #SHEGLAM #SHEGLAMJellyStick #SHEGLAMpartner #foryou #fyp	1,5 M	–	x 4,1 %	59 k	mer. 29 avr., 17:07	328	2,9 k	-	1:20	sheglamsheglamjellysticksheglampartner	original sound nikkietutorials
one of the coolest products on the market is FINALLY BACK! @Haus Labs Atomic Shake Lip Lacquer… where have you been?! #hauslabs #hauslabspartner #foryou #fyp	832 k	–	x 10,3 %	83 k	mer. 22 avr., 17:02	523	2,3 k	-	1:35	hauslabshauslabspartnerforyou	original sound nikkietutorials

@Too Faced the Peach Collection is BACK… and apparently SO AM I!? Let’s dive back into this Peach nostalgia and fall in love with the scents, colors and vibes all over again! 🍑✨ @Ulta Beauty #toofacedpartner

4.1× usual23 M views198 k likes0,9 % eng.ven. 10 juil., 17:022:50No speech

apparently Wet n Wild has even more duochrome magic, so let’s give these Chameleon Chrome Lip Foils a try! #foryou #fyp

1,4 M views144 k likes10,4 % eng.mar. 7 juil., 17:041:28No speech

tap tap tap = filter-like skin in seconds ✨ oh, @loréal paris usa the hype is REAL! 😭❤️ infallible cushion foundation now available exclusively at @Ulta Beauty #LOrealParisPartner #LOrealParisMakeup #MakeupWorthSetting

4,4 M views60 k likes1,4 % eng.mer. 1 juil., 16:551:08No speech

finally trying the VIRAL magical duochrome “Genesis” shadow by Lethal Cosmetics! Is it really THAT good? @India @Lethal Cosmetics #foryou #fyp

1,1 M views117 k likes11,1 % eng.dim. 28 juin, 16:591:34No speech

Line it. Stain it. Glaze it. 💋✨ how INSANE are the Lip Stain & Sculpt + Ultra Shine Lip Glaze from @MCoBeauty UK + @MCoBeauty EU - Luxury beauty without the luxury price tag 💖 OBSESSED! #KissThis #MCoBeautyPartner #MCoBeauty

2,2 M views29 k likes1,3 % eng.jeu. 25 juin, 17:001:48No speech

FINALLY got my hands on the VIRAL dual-ended dupe lipstick 👀✨ Laka Perfect Twin Lip 💋 @Laka US #lakapartner #perfecttwinlip #LakaNewArrivals #foryou #fyp

1,6 M views26 k likes1,7 % eng.dim. 21 juin, 17:001:35No speech

#COSRXPartner Want to know how to pump and plump that skin like a balloon? 🩵💙 The Blue Peptide Bakuchiol Plump Glow Serum by @COSRX Official will give you that kick of bounce ✨😎 #COSRX #KoreanSkincare #PeptideSerum #CopperPeptide

373 k views13 k likes3,4 % eng.ven. 19 juin, 16:581:40No speech

the cheeks of my DREAMS ⋆ using the new @Juvia’s Place Blushed and Bronzed Blurring Pro Palette - soft, buildable and impossible to overdo! @Tijera Fleming #blushbronzeblur#juviasplacepartner #foryou #fyp

9 M views68 k likes0,8 % eng.dim. 14 juin, 16:551:29No speech

23 MILLION views later, I finally tried the VIRAL @missha.official M Perfect Cover Serum BB Cream… and everything makes sense now! #MISSHA #MISSHAPartner #MisshaNewArrivals #foryou #fyp

1,7 M views46 k likes2,7 % eng.ven. 12 juin, 17:011:50No speech

for the people who still need to know they’re going to be okay… HAPPY PRIDE! @Nimya by NikkieTutorials #foryou #fyp

567 k views82 k likes14,8 % eng.jeu. 11 juin, 16:531:17No speech

ngl I kinda ate that last part… (never been more grateful I’m good at makeup) #foryou #fyp #actingchallenge

1,2 M views126 k likes10,9 % eng.dim. 7 juin, 17:001:02No speech

finally trying Moroccan lipstick/lipstain, also known as “aker fassi”! WOW @NikkisSecretx #akerfassi #foryou #fyp

10 M views691 k likes6,8 % eng.dim. 31 mai, 16:551:46No speech

is this the most FULL COVERAGE foundation ever? finally trying the VIRAL @PIMBY products! #foryou #fyp

3,5 M views318 k likes9,2 % eng.lun. 25 mai, 16:561:44No speech

YES! You heard that right… @SHEGLAM available at Kruidvat in The Netherlands + Belgium - gone are the days of waiting for packages to arrive, HALLELUJAH! #sheglam #sheglampartner #kruidvat #fyp #foryou

676 k views41 k likes6,4 % eng.dim. 17 mai, 16:591:23No speech

trying a look with FEATHERS.. cause why not?? @Baya 🦋 @aliyah #foryou #fyp

1,9 M views209 k likes11,3 % eng.jeu. 14 mai, 17:011:41No speech

finally got my hands on the viral GREEN(?!) Wet n Wild duochrome eyeshadow! @Rose Siard #foryou #fyp

3.1× usual18 M views1,4 M likes8,1 % eng.lun. 11 mai, 17:011:31No speech

the routine your undereyes have been waiting for: Eye Duo from @Beauty of Joseon - powered by ginseng & retinal, backed by clinical results! #beautyofjoseonpartner #foryou #fyp

7,3 M views87 k likes1,2 % eng.mar. 5 mai, 17:061:44No speech

trying GLOWING makeup… @muamason #foryou #fyp

1,4 M views156 k likes11,3 % eng.jeu. 30 avr., 17:011:45No speech

“Frost Bite” really is THE ONE! @SHEGLAM these new shades are everything! #SHEGLAM #SHEGLAMJellyStick #SHEGLAMpartner #foryou #fyp

1,5 M views59 k likes4,1 % eng.mer. 29 avr., 17:071:20No speech

one of the coolest products on the market is FINALLY BACK! @Haus Labs Atomic Shake Lip Lacquer… where have you been?! #hauslabs #hauslabspartner #foryou #fyp

832 k views83 k likes10,3 % eng.mer. 22 avr., 17:021:35No speech

30 more videos available

Upgrade to Creator to see all videos and access more detailed analytics.

Want deeper insights?

Analyze this profile with AI-powered insights, competitor tracking, and more.

Now do it for your own TikTok

This is a free public report for @nikkietutorials. Paste your own @username to get the same breakdown, top videos and AI plan, free in your browser.

Brands and agencies: vet @nikkietutorials before a partnership.